PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629394.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 579aa    MW: 65552.1 Da    PI: 5.5743
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629394.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3494.27.1e-151433971353
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksn.ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                     +el++rmw+d+m+lkrlke+k ++   +e a++a+k++  s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+W
  XP_013629394.1  43 DELERRMWRDKMRLKRLKEQKDKS---REGAVDAAKQRqSSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREW 134
                     79********************85...677778777772679***************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT CS
            EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskd 189
                     Wk+kv+fdrngpaaiskyqa+n +++  ++ ++    ++hsl+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+G+e+ww +lgl+k 
  XP_013629394.1 135 WKDKVRFDRNGPAAISKYQAENSVQGVCEGGSSLIGPTPHSLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGEEEWWCQLGLPKG 229
                     *************************999999889************************************************************* PP

                     --.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXXXXXXX CS
            EIN3 190 qgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspkvtlsceqke 282
                     qg+ pykkphdlkkawkv+vLtavikhm p++++ir+l+rqsk+lqdkm+akes+++ls++nqee+++++++++  ++sl+ +s ++ +++ +++
  XP_013629394.1 230 QGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDVAKIRKLVRQSKCLQDKMTAKESATWLSIVNQEESLARELYPEscPPSLSGGSCSLLMNDCSQY 324
                     **************************************************************************76669999************* PP

                     XXX.XXXXXX.X..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
            EIN3 283 dve.gkkeskik..hvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                     dve ++kes  k  + + vk++  +++ rkrk ++++ ++++  ++  tc++  + +s+ + +f d++s+++++
  XP_013629394.1 325 DVEgVEKESLYKveELKPVKEEVPTEFSRKRK-PSRDLNTIMVDRAAFTCENPGCVHSDISRGFLDRSSRDNHQ 397
                     ***75555543311444455555788888888.55555666666788*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.1E-12743294No hitNo description
Gene3DG3DSA:1.10.3180.105.9E-74170304IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.72E-60173297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MMFNEMGMCG NMDFFGELDF CPPPPQPEPV TEEDYTDEEI DVDELERRMW RDKMRLKRLK  60
EQKDKSREGA VDAAKQRQSS QEQARRKKMS RAQDGILKYM LKMMEVCKAQ GFVYGIIPEN  120
GKPVTGASDN LREWWKDKVR FDRNGPAAIS KYQAENSVQG VCEGGSSLIG PTPHSLQELQ  180
DTTLGSLLSA LMQHCDPPQR RFPLEKGVPP PWWPNGEEEW WCQLGLPKGQ GPAPYKKPHD  240
LKKAWKVGVL TAVIKHMFPD VAKIRKLVRQ SKCLQDKMTA KESATWLSIV NQEESLAREL  300
YPESCPPSLS GGSCSLLMND CSQYDVEGVE KESLYKVEEL KPVKEEVPTE FSRKRKPSRD  360
LNTIMVDRAA FTCENPGCVH SDISRGFLDR SSRDNHQLVC PHRDTCVPSR FHLNEVKPVV  420
GYSQPRQPVN SLAQPIDLTG IGVPEDGQKM ISELMSMYDR NVHSSQTSMV MENQSVSLLQ  480
PTVQNHQEHL QFQGNVVEGS FFEDLNIPNR ANNSNQTFFQ GNNFEAALNN SSSNGFQVVY  540
DAPPFDMASF DYRGDMSMVG VVGTMDGMQQ KQQDVSTWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-871723042134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-871723042134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629394.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D3BCG20.0A0A0D3BCG2_BRAOL; Uncharacterized protein
STRINGBra001802.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein